Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HADHB protein

This Human HADHB protein spans the amino acid sequence from region 35-283aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TP-beta 1 domains, 3-ketoacyl-CoA thiolase (EC, 2.3.1.16), Acetyl-CoA acyltrans feraseBeta-ketothiolase

UniProt

P55084

Expression Region

35-283aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fgd6 siRNA Oligos set (Mouse)
20482174 3x 5 nmol

Fgd6 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Rps12 (NM_011295) Mouse Tagged ORF Clone Lentiviral Particle
MR200766L3V 200 µL

Rps12 (NM_011295) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human ATP6V1E1, GST-tagged
ATP6V1E1-10046H 25 µg

Recombinant Human ATP6V1E1, GST-tagged

Sign In for Pricing
View Details
Chicken Interleukin 13 (IL13) ELISA Kit
DLR-IL13-Ch-48T 48 Tests

Chicken Interleukin 13 (IL13) ELISA Kit

Sign In for Pricing
View Details
Human ZNF850 Pre-designed siRNA Set A
SI019118A 1 Each

Human ZNF850 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SMYD4 Polyclonal Antibody
MBS2519201-01 0.02 mL

SMYD4 Polyclonal Antibody

Sign In for Pricing
View Details