Human GM2A protein
This Human GM2A protein spans the amino acid sequence from region 32-193aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cerebroside sulfate activator protein, GM2-APSphingolipid activator protein 3 , SAP-3
UniProt
P17900
Expression Region
32-193aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
44.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB0705-100 1x 100 µL
MART-1 / Melan-A (M2-7C10 + M2-9E3), 0.2mg/mL
Sign In for Pricing
View Details 
BNC042146-100 1x 100 µL
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401836-500 1x 500 µL
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740007-500 1x 500 µL
Cyclin D1 (DCS-6), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details