Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GM2A protein

This Human GM2A protein spans the amino acid sequence from region 32-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cerebroside sulfate activator protein, GM2-APSphingolipid activator protein 3 , SAP-3

UniProt

P17900

Expression Region

32-193aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cep170 Mouse Gene Knockout Kit (CRISPR)
KN503153 1 Kit

Cep170 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BAPTA Rabbit Polyclonal Antibody
AP05075PU-N 100 µg

BAPTA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPATA20 Polyclonal Antibody
E-AB-16072-01 20 µL

SPATA20 Polyclonal Antibody

Sign In for Pricing
View Details
SPATA20 Polyclonal Antibody
E-AB-16072-02 60 µL

SPATA20 Polyclonal Antibody

Sign In for Pricing
View Details
SPATA20 Polyclonal Antibody
E-AB-16072-03 120 µL

SPATA20 Polyclonal Antibody

Sign In for Pricing
View Details
SPATA20 Polyclonal Antibody
E-AB-16072-04 200 µL

SPATA20 Polyclonal Antibody

Sign In for Pricing
View Details