Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FKBP1A protein

This Human FKBP1A protein spans the amino acid sequence from region 2-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

12KDA FK506-binding protein , 12KDA FKBP , FKBP-12, Calstabin-1FK506-binding protein 1A , FKBP-1AImmunophilin FKBP12Rotamase

UniProt

P62942

Expression Region

2-103aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triphenylphosphine
TRC-T808975-500G 500 g

Triphenylphosphine

Sign In for Pricing
View Details
PTEN (C-term) Rabbit Polyclonal Antibody
AP15250PU-N 400 µL

PTEN (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Claudin 18.1 Rabbit Polyclonal Antibody
ER1902-11 100 µL

Claudin 18.1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SFRP2 Mouse Monoclonal Antibody [Clone ID: OTI6E1]
CF807387 100 µg

SFRP2 Mouse Monoclonal Antibody [Clone ID: OTI6E1]

Sign In for Pricing
View Details
Human ABCG5 activation kit by CRISPRa
GA112027 1 Kit

Human ABCG5 activation kit by CRISPRa

Sign In for Pricing
View Details
Des-O-Phosphono T-705RMP-13C5 Diacetate
TRC-D003708-2.5MG 2.5 mg

Des-O-Phosphono T-705RMP-13C5 Diacetate

Sign In for Pricing
View Details