Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTSD protein

This Human CTSD protein spans the amino acid sequence from region 67-403aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CatD, CATD_HUMAN, Cathepsin D, Cathepsin D heavy chain, CD, Ceroid lipofuscinosis neuronal 10, CLN10, CPSD, ctsd, Epididymis secretory sperm binding protein Li 130P, HEL S 130P, Lysosomal aspartyl peptidase, Lysosomal aspartyl protease, MGC2311

UniProt

P07339

Expression Region

67-403aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PTH1R/PTHR1 Antibody [Janelia Fluor 646]
NBP2-99962JF646 0.1 mL

Rabbit Polyclonal PTH1R/PTHR1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Lrrc3 Mouse shRNA Lentiviral Particle (Locus ID 237387)
TL507188V 500 µL Each

Lrrc3 Mouse shRNA Lentiviral Particle (Locus ID 237387)

Sign In for Pricing
View Details
GABRA3 antibody
70R-1528 100 ug

GABRA3 antibody

Sign In for Pricing
View Details
Recombinant Streptomyces griseus subsp. griseus Undecaprenyl-diphosphatase (uppP)
MBS1211076 Inquire

Recombinant Streptomyces griseus subsp. griseus Undecaprenyl-diphosphatase (uppP)

Sign In for Pricing
View Details
Hexyl 4-hydroxybenzoate
T212551-01 10 mg

Hexyl 4-hydroxybenzoate

Sign In for Pricing
View Details
Hexyl 4-hydroxybenzoate
T212551-02 50 mg

Hexyl 4-hydroxybenzoate

Sign In for Pricing
View Details