Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ESYT1 protein

This Human ESYT1 protein spans the amino acid sequence from region 1-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Membrane-bound C2 domain-containing protein

UniProt

Q9BSJ8

Expression Region

1-245aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erythropoietin (EPO) (Marker of Placentation Disorders) (EPO/3793R), CF640R conjugate, 0.1mg/mL
BNC403793-100 1x 100 µL

Erythropoietin (EPO) (Marker of Placentation Disorders) (EPO/3793R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mercury(II) Triflate (2:1)
TRC-M495431-2.5G 2.5 g

Mercury(II) Triflate (2:1)

Sign In for Pricing
View Details
GBA3 Antibody
OC-448-01 50 μL

GBA3 Antibody

Sign In for Pricing
View Details
GBA3 Antibody
OC-448-02 100 µL

GBA3 Antibody

Sign In for Pricing
View Details
GBA3 Antibody
OC-448-03 1 mL

GBA3 Antibody

Sign In for Pricing
View Details
CD7 (NM_006137) Human Recombinant Protein
TP720429XL 1 mg

CD7 (NM_006137) Human Recombinant Protein

Sign In for Pricing
View Details