Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ZNF91 protein

This Human ZNF91 protein spans the amino acid sequence from region 1-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Membrane-bound C2 domain-containing protein

UniProt

Q05481

Expression Region

1-208aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPGTPGSLEMGLLTFRDVAIEFSPEEWQCLDTAQQNLYRNVMLENYRNLAFLGIALSKPDLITYLEQGKEPWNMKQHEMVDEPTGICPHFPQDFWPEQSMEDSFQKVLLRKYEKCGHENLQLRKGCKSVDECKVHKEGYNKLNQCLTTAQSKVFQCGKYLKVFYKFLNSNRHTIRHTGKKCFKCKKCVKSFCIRLHKTQHKCVYITEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mvp qPCR Primer Pair
QM46086S 200 Tests

Mouse Mvp qPCR Primer Pair

Sign In for Pricing
View Details
Sensor, acrylic block for Spill Alarm & Cut Off
108A SP-AB 1 Each

Sensor, acrylic block for Spill Alarm & Cut Off

Sign In for Pricing
View Details
Mouse Monoclonal RPS6KC1 Antibody (OTI10F11) [Alexa Fluor 700]
NBP2-73946AF700 0.1 mL

Mouse Monoclonal RPS6KC1 Antibody (OTI10F11) [Alexa Fluor 700]

Sign In for Pricing
View Details
ZWINT Rabbit Polyclonal Antibody (APC)
orb2602076 100 µg

ZWINT Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Dab2 Double Nickase Plasmid (h2)
sc-400979-NIC-2 20 µg

Dab2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
TFIIF RAP 74 Lentiviral Activation Particles (h2)
sc-405237-LAC-2 200 µL

TFIIF RAP 74 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details