Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ZNF91 protein

This Human ZNF91 protein spans the amino acid sequence from region 1-208aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Membrane-bound C2 domain-containing protein

UniProt

Q05481

Expression Region

1-208aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPGTPGSLEMGLLTFRDVAIEFSPEEWQCLDTAQQNLYRNVMLENYRNLAFLGIALSKPDLITYLEQGKEPWNMKQHEMVDEPTGICPHFPQDFWPEQSMEDSFQKVLLRKYEKCGHENLQLRKGCKSVDECKVHKEGYNKLNQCLTTAQSKVFQCGKYLKVFYKFLNSNRHTIRHTGKKCFKCKKCVKSFCIRLHKTQHKCVYITEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL19P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV777314 1.0 µg DNA

RPL19P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Heat Shock Protein 90 kDa Alpha A1 (HSP90aA1) Antibody (Biotin)
abx274262-01 200 µL

Heat Shock Protein 90 kDa Alpha A1 (HSP90aA1) Antibody (Biotin)

Sign In for Pricing
View Details
Heat Shock Protein 90 kDa Alpha A1 (HSP90aA1) Antibody (Biotin)
abx274262-02 1 mL

Heat Shock Protein 90 kDa Alpha A1 (HSP90aA1) Antibody (Biotin)

Sign In for Pricing
View Details
Compound 0080-0056
T131691-01 5 mg

Compound 0080-0056

Sign In for Pricing
View Details
Compound 0080-0056
T131691-02 1 mg

Compound 0080-0056

Sign In for Pricing
View Details
Trans-3-Chloroacrylic acid
sc-229504 1 g

Trans-3-Chloroacrylic acid

Sign In for Pricing
View Details