Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SDHA protein

This Human SDHA protein spans the amino acid sequence from region 44-293aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Flavoprotein subunit of complex II , Fp

UniProt

P31040

Expression Region

44-293aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRLF3, CT (CRLF3, CREME9, CYTOR4, P48, Cytokine receptor-like factor 3, Cytokine receptor-like molecule 9, Cytokine receptor-related protein 4, Type I cytokine receptor-like factor p48) (MaxLight 650) discontinued
034235-ML650 100 µL

CRLF3, CT (CRLF3, CREME9, CYTOR4, P48, Cytokine receptor-like factor 3, Cytokine receptor-like molecule 9, Cytokine receptor-related protein 4, Type I cytokine receptor-like factor p48) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Cox6c ORF Vector (Rat) (pORF)
16709016 1.0 µg DNA

Cox6c ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ResDetect™ resDNA Sample Preparation Prefilled Kit (Magnetic Beads)
OPA-R023-32preps 32 Preparation

ResDetect™ resDNA Sample Preparation Prefilled Kit (Magnetic Beads)

Sign In for Pricing
View Details
Anti-BMP4 Antibody Picoband® (PE Conjugate)
PB9688-PE 100 µg/Vial

Anti-BMP4 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
Tm2d3 (NM_178056) Mouse Tagged Lenti ORF Clone
MR217505L3 10 µg

Tm2d3 (NM_178056) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
2-Hexenedioic acid
OR53046-01 250 mg

2-Hexenedioic acid

Sign In for Pricing
View Details