Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SDHA protein

This Human SDHA protein spans the amino acid sequence from region 44-293aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Flavoprotein subunit of complex II , Fp

UniProt

P31040

Expression Region

44-293aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLP1R Polyclonal Antibody
E11-2036158 100 µg -100 µL

GLP1R Polyclonal Antibody

Sign In for Pricing
View Details
NOD-IN-1 10mM * 1mL in DMSO
A13171-10mM-D 10 mM x 1mL in DMSO

NOD-IN-1 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Human ZNF829 Recombinant Protein (N-His)
HD531012-01 50 µg

Human ZNF829 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human ZNF829 Recombinant Protein (N-His)
HD531012-02 100 µg

Human ZNF829 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human ZNF829 Recombinant Protein (N-His)
HD531012-03 1 mg

Human ZNF829 Recombinant Protein (N-His)

Sign In for Pricing
View Details
GPM6B (Biotin)
564034-01 50 µg

GPM6B (Biotin)

Sign In for Pricing
View Details