Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H3F3A protein

This Human H3F3A protein spans the amino acid sequence from region 2-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H3 histone family 3A, H3 histone family 3B, H3 histone, family 3B (H3.3B), H3.3, H3.3A, H3.3B, H33_HUMAN, H3F3, H3F3A, H3f3b, Histone H3.3, Histone H3.3Q, Histone H3.A, Histone H3.B, MGC87782, MGC87783

UniProt

P84243

Expression Region

2-136aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSHB Recombinant Protein (Human)
OPCA03972-100UG 100 µg

TSHB Recombinant Protein (Human)

Sign In for Pricing
View Details
Rat Cross Linked C-Telopeptide Of Type II Collagen (CTX-II) Elisa Kit
EK721066 96 Well

Rat Cross Linked C-Telopeptide Of Type II Collagen (CTX-II) Elisa Kit

Sign In for Pricing
View Details
PPP1R15A antibody
MBS832115-01 0.1 mL

PPP1R15A antibody

Sign In for Pricing
View Details
PPP1R15A antibody
MBS832115-02 5x 0.1 mL

PPP1R15A antibody

Sign In for Pricing
View Details
L-Lysinamide dihydrochloride
orb3181461-01 10 mg

L-Lysinamide dihydrochloride

Sign In for Pricing
View Details
L-Lysinamide dihydrochloride
orb3181461-02 50 mg

L-Lysinamide dihydrochloride

Sign In for Pricing
View Details