Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H3F3A protein

This Human H3F3A protein spans the amino acid sequence from region 2-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H3 histone family 3A, H3 histone family 3B, H3 histone, family 3B (H3.3B), H3.3, H3.3A, H3.3B, H33_HUMAN, H3F3, H3F3A, H3f3b, Histone H3.3, Histone H3.3Q, Histone H3.A, Histone H3.B, MGC87782, MGC87783

UniProt

P84243

Expression Region

2-136aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENO1 Antibody
28-773 100 µL

ENO1 Antibody

Sign In for Pricing
View Details
IL1F7 Blocking Peptide
MBS9620448-01 1 mg

IL1F7 Blocking Peptide

Sign In for Pricing
View Details
IL1F7 Blocking Peptide
MBS9620448-02 5x 1 mg

IL1F7 Blocking Peptide

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 5A (WNT5A) ELISA Kit
orb1662795-01 48 Tests

Human Wingless Type MMTV Integration Site Family, Member 5A (WNT5A) ELISA Kit

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 5A (WNT5A) ELISA Kit
orb1662795-02 96 Tests

Human Wingless Type MMTV Integration Site Family, Member 5A (WNT5A) ELISA Kit

Sign In for Pricing
View Details
OGDH Polyclonal Antibody
29113-01 50 µL

OGDH Polyclonal Antibody

Sign In for Pricing
View Details