Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LDHB protein

This Human LDHB protein spans the amino acid sequence from region 2-334aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LDH heart subunit , LDH-HRenal carcinoma antigen NY-REN-46

UniProt

P07195

Expression Region

2-334aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MH7A Cell Line
CL-0747 1x 10^6 Cells/Vial - 2 Vials

MH7A Cell Line

Sign In for Pricing
View Details
3-Chloro-5-methylpyridine 98+% (GC)
231808-01 1 g

3-Chloro-5-methylpyridine 98+% (GC)

Sign In for Pricing
View Details
3-Chloro-5-methylpyridine 98+% (GC)
231808-02 5 g

3-Chloro-5-methylpyridine 98+% (GC)

Sign In for Pricing
View Details
3-Chloro-5-methylpyridine 98+% (GC)
231808-03 25 g

3-Chloro-5-methylpyridine 98+% (GC)

Sign In for Pricing
View Details
PLA2G7 protein (His tag)
80R-4045 50 ug

PLA2G7 protein (His tag)

Sign In for Pricing
View Details
Histone H4 (Di Methyl Lys79) discontinued
347393-01 100 µL

Histone H4 (Di Methyl Lys79) discontinued

Sign In for Pricing
View Details