Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PRDX1 protein

This Human PRDX1 protein spans the amino acid sequence from region 1-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Natural killer cell-enhancing factor A , NKEF-AProliferation-associated gene protein , PAGThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2

UniProt

Q06830

Expression Region

1-199aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIOTIN*Rabbit Anti Guinea Pig IgG
MBS9526229-01 0.1 mL

BIOTIN*Rabbit Anti Guinea Pig IgG

Sign In for Pricing
View Details
BIOTIN*Rabbit Anti Guinea Pig IgG
MBS9526229-02 5x 0.1 mL

BIOTIN*Rabbit Anti Guinea Pig IgG

Sign In for Pricing
View Details
NTMT1 Knockout NCI-H1299 Polyclonal Cells
ARG17863 1 Million

NTMT1 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
His tag Mouse mAb, PE-Cy5 conjugated
orb3163048 100 µL

His tag Mouse mAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
4-Isobutyl-3-nitrophenylboronic acid
432872-01 100 mg

4-Isobutyl-3-nitrophenylboronic acid

Sign In for Pricing
View Details
4-Isobutyl-3-nitrophenylboronic acid
432872-02 250 mg

4-Isobutyl-3-nitrophenylboronic acid

Sign In for Pricing
View Details