Human ADAR protein
This Human ADAR protein spans the amino acid sequence from region 1-176aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
136KDA double-stranded RNA-binding protein , p136Interferon-inducible protein 4 , IFI-4K88DSRBP
UniProt
P55265
Expression Region
1-176aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2031929-01 24 Strip Well
Bovine Hyaluronoglucosaminidase 1 (HYAL1) ELISA Kit
Sign In for Pricing
View Details MBS2031929-02 48 Strip Well
Bovine Hyaluronoglucosaminidase 1 (HYAL1) ELISA Kit
Sign In for Pricing
View Details MBS2031929-03 96 Strip Well
Bovine Hyaluronoglucosaminidase 1 (HYAL1) ELISA Kit
Sign In for Pricing
View Details MBS2031929-04 5x 96 Strip Well
Bovine Hyaluronoglucosaminidase 1 (HYAL1) ELISA Kit
Sign In for Pricing
View Details MBS2031929-05 10x 96 Strip Well
Bovine Hyaluronoglucosaminidase 1 (HYAL1) ELISA Kit
Sign In for Pricing
View Details 
M4104-100 100 Per Pack
EZBlock™ Blocking Buffer and Signal Enhancer
Sign In for Pricing
View Details