Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ADAR protein

This Human ADAR protein spans the amino acid sequence from region 1-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

136KDA double-stranded RNA-binding protein , p136Interferon-inducible protein 4 , IFI-4K88DSRBP

UniProt

P55265

Expression Region

1-176aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKG2D antibody (PE)
MBS834175-01 0.1 mg

NKG2D antibody (PE)

Sign In for Pricing
View Details
NKG2D antibody (PE)
MBS834175-02 5x 0.1 mg

NKG2D antibody (PE)

Sign In for Pricing
View Details
PCMV-FZD2-3xFLAG-Neo Plasmid
PVT63742 2 µg

PCMV-FZD2-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
Rabbit anti-human Metallothionein-1A polyclonal Antibody, HRP conjugated
MBS1488291-01 0.05 mg

Rabbit anti-human Metallothionein-1A polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Metallothionein-1A polyclonal Antibody, HRP conjugated
MBS1488291-02 0.1 mg

Rabbit anti-human Metallothionein-1A polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Metallothionein-1A polyclonal Antibody, HRP conjugated
MBS1488291-03 5x 0.1 mg

Rabbit anti-human Metallothionein-1A polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details