Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human YARS protein

This Human YARS protein spans the amino acid sequence from region 2-528aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tyrosyl-tRNA synthetase , TyrRS

UniProt

P54577

Expression Region

2-528aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

86 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Syne4 qPCR Primer Pair
QM60398S 200 Tests

Mouse Syne4 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Limd2 Pre-designed siRNA Set A
SI107562A 1 Each

Mouse Limd2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PGC1 beta Rabbit Polyclonal Antibody (HRP)
orb480893 100 µL

PGC1 beta Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
LOC100360106 3'UTR Luciferase Stable Cell Line
TU207442 1.0 mL

LOC100360106 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Ar-V7-IN-1
BA9187-10 10 mg

Ar-V7-IN-1

Sign In for Pricing
View Details
PIRC70 Protein Vector (Human) (pPM-C-HA)
PV111440 500 ng

PIRC70 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details