Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSTB protein

This Human CSTB protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CPI-BLiver thiol proteinase inhibitorStefin-B

UniProt

P04080

Expression Region

1-98aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI9F11]
CF810509 100 µg

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI9F11]

Sign In for Pricing
View Details
5- (Perfluoroethyl) pyridazin-3-amine
PC1008041-01 100 mg

5- (Perfluoroethyl) pyridazin-3-amine

Sign In for Pricing
View Details
5- (Perfluoroethyl) pyridazin-3-amine
PC1008041-02 250 mg

5- (Perfluoroethyl) pyridazin-3-amine

Sign In for Pricing
View Details
5- (Perfluoroethyl) pyridazin-3-amine
PC1008041-03 1 g

5- (Perfluoroethyl) pyridazin-3-amine

Sign In for Pricing
View Details
5- (Perfluoroethyl) pyridazin-3-amine
PC1008041-04 5 g

5- (Perfluoroethyl) pyridazin-3-amine

Sign In for Pricing
View Details
Rabbit anti-IL-36A Antibody
MBS4505323-01 0.05 mL

Rabbit anti-IL-36A Antibody

Sign In for Pricing
View Details