Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSTB protein

This Human CSTB protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CPI-BLiver thiol proteinase inhibitorStefin-B

UniProt

P04080

Expression Region

1-98aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18-M30 (CK 18-M30) Bovine ELISA Kit
A0990 96 Tests

Cytokeratin 18-M30 (CK 18-M30) Bovine ELISA Kit

Sign In for Pricing
View Details
CK12 Rabbit Polyclonal Antibody (PerCP)
orb2416195 100 µL

CK12 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
C-erbB-2/HER2 Mouse mAb, PerCP-Cy7 conjugated
orb2864147 100 µL

C-erbB-2/HER2 Mouse mAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Accn2 sgRNA CRISPR Lentivector set (Mouse)
K4801201 3x 1.0 µg

Accn2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
NCAM2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-11094R-BF555 100 µL

NCAM2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
2- (3,5-Dibromophenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
273234-01 250 mg

2- (3,5-Dibromophenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details