Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus genotype 1a Genome polyprotein protein

This Virus genotype 1a Genome polyprotein protein spans the amino acid sequence from region 192-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Genome polyprotein [Cleaved into, Core protein p21, Capsid protein C, p21), Core protein p19, Envelope glycoprotein E1, gp32, gp35), Envelope glycoprotein E2, NS1, gp68, gp70), p7, Protease NS2-3, p23, EC 3.4.22.-), Serine protease NS3, EC 3.4.21.98, EC 3.6.1.15, EC 3.6.4.13, Hepacivirin, NS3P, p70), Non-structural protein 4A, NS4A, p8), Non-structural protein 4B, NS4B, p27), Non-structural protein 5A, NS5A, p56), RNA-directed RNA polymerase, EC 2.7.7.48, NS5B, p68) ]

UniProt

P26664

Expression Region

192-325aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Hepatitis C virus genotype 1a (isolate 1) (HCV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YQVRNSTGLYHVTNDCPNSSIVYEAADAILHTPGCVPCVREGNASRCWVAMTPTVATRDGKLPATQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRRHWTTQGCNCSIYPGHITGHRMAWDMMMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMOD1 Antibody
KC-32918-01 50 μL

TMOD1 Antibody

Sign In for Pricing
View Details
TMOD1 Antibody
KC-32918-02 100 µL

TMOD1 Antibody

Sign In for Pricing
View Details
TMOD1 Antibody
KC-32918-03 1 mL

TMOD1 Antibody

Sign In for Pricing
View Details
Human SH2D1B activation kit by CRISPRa
GA114630 1 Kit

Human SH2D1B activation kit by CRISPRa

Sign In for Pricing
View Details
Perfluorohexanesulfonic Acid (Technical Grade)
TRC-P999738-50MG 50 mg

Perfluorohexanesulfonic Acid (Technical Grade)

Sign In for Pricing
View Details
TAPA1 (CD81) (NM_004356) Human Over-expression Lysate
LC418041 20 µg

TAPA1 (CD81) (NM_004356) Human Over-expression Lysate

Sign In for Pricing
View Details