Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF1B protein

This Human TNFRSF1B protein spans the amino acid sequence from region 27-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor 2 , TNF-R2Tumor necrosis factor receptor type II , TNF-RII , TNFR-IIp75p80 TNF-alpha receptor, CD120bINN, Etanercept

UniProt

P20333

Expression Region

27-203aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTST

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibitor mmu-miR-6412 AAV miRNA Vector
Amm3130500 500 ng

Inhibitor mmu-miR-6412 AAV miRNA Vector

Sign In for Pricing
View Details
Recombinant Human FLRT3 Protein (His Tag)
PKSH033675-01 10 µg

Recombinant Human FLRT3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FLRT3 Protein (His Tag)
PKSH033675-02 50 µg

Recombinant Human FLRT3 Protein (His Tag)

Sign In for Pricing
View Details
Anti-Cyclin B1/CCNB1 Antibody Picoband®
A00745-1 100 µg/Vial

Anti-Cyclin B1/CCNB1 Antibody Picoband®

Sign In for Pricing
View Details
ADORA1 siRNA (Mouse)
orb1849203-01 15 nmol

ADORA1 siRNA (Mouse)

Sign In for Pricing
View Details
ADORA1 siRNA (Mouse)
orb1849203-02 30 nmol

ADORA1 siRNA (Mouse)

Sign In for Pricing
View Details