Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF1B protein

This Human TNFRSF1B protein spans the amino acid sequence from region 27-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor 2 , TNF-R2Tumor necrosis factor receptor type II , TNF-RII , TNFR-IIp75p80 TNF-alpha receptor, CD120bINN, Etanercept

UniProt

P20333

Expression Region

27-203aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTST

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella schwarzengrund Protein CrcB homolog (crcB)
MBS1154505 Inquire

Recombinant Salmonella schwarzengrund Protein CrcB homolog (crcB)

Sign In for Pricing
View Details
Octenyl succinic anhydride
M36448-01 1 g

Octenyl succinic anhydride

Sign In for Pricing
View Details
Octenyl succinic anhydride
M36448-02 500 mg

Octenyl succinic anhydride

Sign In for Pricing
View Details
Octenyl succinic anhydride
M36448-03 200 mg

Octenyl succinic anhydride

Sign In for Pricing
View Details
Octenyl succinic anhydride
M36448-04 Inquire

Octenyl succinic anhydride

Sign In for Pricing
View Details
NSD1 Antibody
orb2672250-01 50 µL

NSD1 Antibody

Sign In for Pricing
View Details