Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF1B protein

This Human TNFRSF1B protein spans the amino acid sequence from region 27-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor 2 , TNF-R2Tumor necrosis factor receptor type II , TNF-RII , TNFR-IIp75p80 TNF-alpha receptor, CD120bINN, Etanercept

UniProt

P20333

Expression Region

27-203aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTST

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARA54 Polyclonal Antibody
RA22031-01 50 µL

ARA54 Polyclonal Antibody

Sign In for Pricing
View Details
ARA54 Polyclonal Antibody
RA22031-02 100 µL

ARA54 Polyclonal Antibody

Sign In for Pricing
View Details
DLGAP4 (NM_183006) Human Untagged Clone
SC110271 10 µg

DLGAP4 (NM_183006) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Shigella Flexneri mdh Protein (aa 1-312)
VAng-Lsx07911-50gEcoli 50 µg (E. coli)

Recombinant Shigella Flexneri mdh Protein (aa 1-312)

Sign In for Pricing
View Details
MCM10 (NM_018518) Human Tagged Lenti ORF Clone
RC210997L1 10 µg

MCM10 (NM_018518) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cartridge Fuses
2020760/4 1 Each

Cartridge Fuses

Sign In for Pricing
View Details