Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ms4a1 protein

This Mouse Ms4a1 protein spans the amino acid sequence from region 132-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20

UniProt

P19437

Expression Region

132-291aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (MaxLight 750)
MBS6238807-01 0.1 mL

ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (MaxLight 750)

Sign In for Pricing
View Details
ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (MaxLight 750)
MBS6238807-02 5x 0.1 mL

ID1 (Inhibitor of DNA Binding 1, Dominant Negative Helix-loop-Helix Protein, ID, bHLHb24) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral mouse Sh3bgrl3 shRNA (UAS) - Lentiviral mouse Sh3bgrl3 shRNA (UAS, iRFP) (25)
GTR15193802 1 Vial

Lentiviral mouse Sh3bgrl3 shRNA (UAS) - Lentiviral mouse Sh3bgrl3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Chicken Tenascin ELISA Kit
MBS2885189-01 48 Well

Chicken Tenascin ELISA Kit

Sign In for Pricing
View Details
Chicken Tenascin ELISA Kit
MBS2885189-02 96 Well

Chicken Tenascin ELISA Kit

Sign In for Pricing
View Details
Chicken Tenascin ELISA Kit
MBS2885189-03 5x 96 Well

Chicken Tenascin ELISA Kit

Sign In for Pricing
View Details