Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse l2rb protein

This Mouse l2rb protein spans the amino acid sequence from region 24-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

High affinity IL-2 receptor subunit betap70-75, CD122

UniProt

P16297

Expression Region

24-240aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-5009-5p mimic
HY-R01502-01 5 nmol

Hsa-miR-5009-5p mimic

Sign In for Pricing
View Details
Hsa-miR-5009-5p mimic
HY-R01502-02 20 nmol

Hsa-miR-5009-5p mimic

Sign In for Pricing
View Details
hsa-miR-7852-3p Primers
MPH03889 150 µL / 10 µM

hsa-miR-7852-3p Primers

Sign In for Pricing
View Details
SRSF7 Recombinant Protein (Human)
RP100158 100 µg

SRSF7 Recombinant Protein (Human)

Sign In for Pricing
View Details
CTNNBL1 Rabbit Polyclonal Antibody (Biotin)
orb2657460 100 µg

CTNNBL1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Anti-Cathepsin A 32k Antibody
CPA1918-01 30 µL

Anti-Cathepsin A 32k Antibody

Sign In for Pricing
View Details