Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EZR protein

This Human EZR protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CytovillinVillin-2p81

UniProt

P15311

Expression Region

1-251aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Pan Methyl Lysine Polyclonal Antibody
PA85342GE-01 50 µg

Rabbit Anti-Pan Methyl Lysine Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Pan Methyl Lysine Polyclonal Antibody
PA85342GE-02 100 µg

Rabbit Anti-Pan Methyl Lysine Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Pan Methyl Lysine Polyclonal Antibody
PA85342GE-03 500 µg

Rabbit Anti-Pan Methyl Lysine Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Pan Methyl Lysine Polyclonal Antibody
PA85342GE-04 1 mg

Rabbit Anti-Pan Methyl Lysine Polyclonal Antibody

Sign In for Pricing
View Details
AUH siRNA Oligos set (Human)
12863171 3x 5 nmol

AUH siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal LECT2 Antibody (OTI2A11) [Alexa Fluor 532]
NBP2-71122AF532 0.1 mL

Mouse Monoclonal LECT2 Antibody (OTI2A11) [Alexa Fluor 532]

Sign In for Pricing
View Details