Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EZR protein

This Human EZR protein spans the amino acid sequence from region 1-251aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CytovillinVillin-2p81

UniProt

P15311

Expression Region

1-251aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dot1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4454308 1.0 µg DNA

Dot1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
H-FABP Rapid Test Cassette
CFA-402 10 Tests

H-FABP Rapid Test Cassette

Sign In for Pricing
View Details
Canine Pyruvate kinase isozymes R/L, PKLR GENLISA ELISA
KLN0371 96 Well

Canine Pyruvate kinase isozymes R/L, PKLR GENLISA ELISA

Sign In for Pricing
View Details
Alpha 1 Fetoprotein/AFP Rabbit Polyclonal Antibody (Carrier-free)
orb3078910 100 µg

Alpha 1 Fetoprotein/AFP Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Coronavirus (SARS-CoV-2) Antigen + Influenza A&B + RSV + Adenovirus + M. pneumoniae - Antigen, Combo, Nasopharyngeal swab - 20/sets: cassette + nasopharyngeal swab + tube + buffer + dropper
IRT-555 20 Kits/Set

Coronavirus (SARS-CoV-2) Antigen + Influenza A&B + RSV + Adenovirus + M. pneumoniae - Antigen, Combo, Nasopharyngeal swab - 20/sets: cassette + nasopharyngeal swab + tube + buffer + dropper

Sign In for Pricing
View Details
CALR Recombinant Protein (Human)
OPED00014-50UG 50 µg

CALR Recombinant Protein (Human)

Sign In for Pricing
View Details