Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Polymerase acidic protein

This Viral Polymerase acidic protein spans the amino acid sequence from region 124-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNA-directed RNA polymerase subunit P2

UniProt

Q9IQ47

Expression Region

124-247aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Influenza A virus (strain A/x-31 H3N2)

Field of Research

Infectious Disease & Virology; Molecular Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 124-247aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GDF2 ELISA Kit
ELA-E1728h 96 Tests

Human GDF2 ELISA Kit

Sign In for Pricing
View Details
Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit
MBS9357434-01 48 Well

Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit

Sign In for Pricing
View Details
Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit
MBS9357434-02 96 Well

Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit

Sign In for Pricing
View Details
Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit
MBS9357434-03 5x 96 Well

Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit

Sign In for Pricing
View Details
Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit
MBS9357434-04 10x 96 Well

Mouse Keyhole Limpet Hemocyanin Antibody IgG (KLH-IgG) ELISA Kit

Sign In for Pricing
View Details
STFR M024-148x210-PE-CRD/1 AC Signs
821411 Card of 1 Pictogram(s)

STFR M024-148x210-PE-CRD/1 AC Signs

Sign In for Pricing
View Details