Viral Envelope glycoprotein B protein
This Viral Envelope glycoprotein B protein spans the amino acid sequence from region 745-854aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
GB, UL55, Envelope glycoprotein B, gB
UniProt
P89053
Expression Region
745-854aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Rhesus cytomegalovirus (strain 68-1) (RhCMV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 745-854aaSequence Info: Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN430944 1 Kit
Small leucine rich protein 1 (SmLR1) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
BNC041019-100 1x 100 µL
CD50 (ICAM-3) (ICAM3/1019), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401527-100 1x 100 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
