Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Matrix protein

This Viral Matrix protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphoprotein M2

UniProt

P25223

Expression Region

1-202aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rabies virus (strain CVS-11) (RABV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-202aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human VN1R5 shRNA (UAS) - Lentiviral human VN1R5 shRNA (UAS, iRFP) (100)
GTR15332370 1 Vial

Lentiviral human VN1R5 shRNA (UAS) - Lentiviral human VN1R5 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CLDN1
311077-01 50 µL

CLDN1

Sign In for Pricing
View Details
CLDN1
311077-02 100 µL

CLDN1

Sign In for Pricing
View Details
CHTF8 siRNA (Human)
orb1857934-01 15 nmol

CHTF8 siRNA (Human)

Sign In for Pricing
View Details
CHTF8 siRNA (Human)
orb1857934-02 30 nmol

CHTF8 siRNA (Human)

Sign In for Pricing
View Details
ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2, neuro/glioblastoma Derived Oncogene Homolog (avian), CD340, HER-2, HER-2/neu, HER2, NEU, NGL, TKR1) (PE)
245805-PE 100 µL

ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2, neuro/glioblastoma Derived Oncogene Homolog (avian), CD340, HER-2, HER-2/neu, HER2, NEU, NGL, TKR1) (PE)

Sign In for Pricing
View Details