Viral Matrix protein
This Viral Matrix protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Phosphoprotein M2
UniProt
P25223
Expression Region
1-202aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Rabies virus (strain CVS-11) (RABV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-202aaSequence Info: Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15090039 1 Vial
Lentiviral human CALY shRNA (UAS) - Lentiviral human CALY shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
GTR15289920 1 Vial
Lentiviral mouse Gtf2e2 shRNA (UAS) - Lentiviral mouse Gtf2e2 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details CSB-EP005832HU-01 20 µg
Recombinant Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)
Sign In for Pricing
View Details