Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Matrix protein

This Viral Matrix protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphoprotein M2

UniProt

P25223

Expression Region

1-202aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rabies virus (strain CVS-11) (RABV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-202aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRD1 Antibody, FITC conjugated
CSB-PA007178LC01HU-01 50 µg

DRD1 Antibody, FITC conjugated

Sign In for Pricing
View Details
DRD1 Antibody, FITC conjugated
CSB-PA007178LC01HU-02 100 µg

DRD1 Antibody, FITC conjugated

Sign In for Pricing
View Details
EIF5A Rabbit Polyclonal Antibody
orb1174789 100 µg

EIF5A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Complement C3 (C3) ELISA Kit
YP-W19231-01 48 Tests

Human Complement C3 (C3) ELISA Kit

Sign In for Pricing
View Details
Human Complement C3 (C3) ELISA Kit
YP-W19231-02 96 Tests

Human Complement C3 (C3) ELISA Kit

Sign In for Pricing
View Details
Mouse Taste Receptor Type 1 Member 2 (TAS1R2) ELISA Kit
MBS4502739-01 48 Tests

Mouse Taste Receptor Type 1 Member 2 (TAS1R2) ELISA Kit

Sign In for Pricing
View Details