Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Nucleoprotein protein

This Viral Nucleoprotein protein spans the amino acid sequence from region 488-739aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

P18272

Expression Region

488-739aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 488-739aaSequence Info: Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Synaptotagmin XI (SYT11) ELISA Kit
QY-E01181 96 Tests

Human Synaptotagmin XI (SYT11) ELISA Kit

Sign In for Pricing
View Details
ChM-1 (H-10) : m-IgG2b BP-HRP Bundle
sc-548726 1 Kit

ChM-1 (H-10) : m-IgG2b BP-HRP Bundle

Sign In for Pricing
View Details
LONRF3 Antibody
orb1266668 400 μl

LONRF3 Antibody

Sign In for Pricing
View Details
C1GALT1C1 Rabbit Polyclonal Antibody (BF555)
orb2521189 100 µL

C1GALT1C1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
OR2L8 Antibody (C-term)
MBS9209815-01 0.08 mL

OR2L8 Antibody (C-term)

Sign In for Pricing
View Details
OR2L8 Antibody (C-term)
MBS9209815-02 0.4 mL

OR2L8 Antibody (C-term)

Sign In for Pricing
View Details