Viral Spike glycoprotein protein
This Viral Spike glycoprotein protein spans the amino acid sequence from region 326-540aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
E2 Peplomer protein
UniProt
P15777
Expression Region
326-540aa
Tag
N-terminal 10xHis-tagged
Source
E.coli
Origin
Bovine coronavirus (strain Mebus) (BCoV) (BCV)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: N-terminal 10xHis-taggedExpression Region: 326-540aaSequence Info: Extracellular Domain
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2221-500 1x 500 µL
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP02564PU-S 50 µL
c-Jun (JUN) non phospho Thr93 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC472336-100 1x 100 µL
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1366-500 1x 500 µL
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details