Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Spike glycoprotein protein

This Viral Spike glycoprotein protein spans the amino acid sequence from region 326-540aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E2 Peplomer protein

UniProt

P15777

Expression Region

326-540aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Bovine coronavirus (strain Mebus) (BCoV) (BCV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 326-540aaSequence Info: Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPSNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCNCLCTPDPIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucolipin 1 (MCOLN1) Human Gene Knockout Kit (CRISPR)
KN201010RB 1 Kit

Mucolipin 1 (MCOLN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MDM2 (MDM2/2414), CF640R conjugate, 0.1mg/mL
BNC402414-100 1x 100 µL

MDM2 (MDM2/2414), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Syntaxin-8/STX8 Protein
PKSH033094-01 10 µg

Recombinant Human Syntaxin-8/STX8 Protein

Sign In for Pricing
View Details
Recombinant Human Syntaxin-8/STX8 Protein
PKSH033094-02 50 µg

Recombinant Human Syntaxin-8/STX8 Protein

Sign In for Pricing
View Details
Recombinant PRDX3 Antibody
RN-12207-01 50 μL

Recombinant PRDX3 Antibody

Sign In for Pricing
View Details
Recombinant PRDX3 Antibody
RN-12207-02 100 µL

Recombinant PRDX3 Antibody

Sign In for Pricing
View Details