Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Nucleoprotein protein

This Viral Nucleoprotein protein spans the amino acid sequence from region 1-235aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

P04873

Expression Region

1-235aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Bunyavirus La Crosse

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 1-235aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zeaxanthin Diacetate
TRC-Z275010-250MG 250 mg

Zeaxanthin Diacetate

Sign In for Pricing
View Details
Islr Mouse Gene Knockout Kit (CRISPR)
KN308455BN 1 Kit

Islr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Dio2 activation kit by CRISPRa
GA201074 1 Kit

Mouse Dio2 activation kit by CRISPRa

Sign In for Pricing
View Details
D-(-)-2-Phenylglycine
TRC-P327125-1G 1 g

D-(-)-2-Phenylglycine

Sign In for Pricing
View Details
PRPS1 (NM_002764) Human Over-expression Lysate
LC400979 20 µg

PRPS1 (NM_002764) Human Over-expression Lysate

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF594 conjugate, 0.1mg/mL
BNC942044-100 1x 100 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details