Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Nucleoprotein protein

This Viral Nucleoprotein protein spans the amino acid sequence from region 1-235aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

P04873

Expression Region

1-235aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Bunyavirus La Crosse

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-taggedExpression Region: 1-235aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zmat4 Mouse Gene Knockout Kit (CRISPR)
KN520104 1 Kit

Zmat4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Rbm4 activation kit by CRISPRa
GA203585 1 Kit

Mouse Rbm4 activation kit by CRISPRa

Sign In for Pricing
View Details
TentaGel® S Ramage
S30025.50G 50 g

TentaGel® S Ramage

Sign In for Pricing
View Details
1-Bromo-4-(4-chlorophenyl)butan-2-one
TRC-B681820-10MG 10 mg

1-Bromo-4-(4-chlorophenyl)butan-2-one

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse TNFα Antibody[XT3.11]
AN00567M-01 50 Tests

Elab Fluor® 647 Anti-Mouse TNFα Antibody[XT3.11]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse TNFα Antibody[XT3.11]
AN00567M-02 100 Tests

Elab Fluor® 647 Anti-Mouse TNFα Antibody[XT3.11]

Sign In for Pricing
View Details