What is the catalog number for Viral Nucleoprotein protein?

The catalog number for Viral Nucleoprotein protein is orb419338.

What sizes are available for Viral Nucleoprotein protein?

Viral Nucleoprotein protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Viral Nucleoprotein protein come in?

Viral Nucleoprotein protein is available in 3 different pack sizes.

Is Viral Nucleoprotein protein in stock?

Viral Nucleoprotein protein is currently made to order / not held in immediate stock. Contact us for lead time.

Viral Nucleoprotein protein

This Viral Nucleoprotein protein spans the amino acid sequence from region 1-235aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

P04873

Expression Region

1-235aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bunyavirus La Crosse

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-235aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP