Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Myoglobin protein

This Mouse Myoglobin protein spans the amino acid sequence from region 2-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mb, Myoglobin

UniProt

P04247

Expression Region

2-154aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 2-154aaSequence Info: Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)
MBS1367823-01 0.02 mg (E-Coli)

Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)

Sign In for Pricing
View Details
Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)
MBS1367823-02 0.02 mg (Yeast)

Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)

Sign In for Pricing
View Details
Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)
MBS1367823-03 0.1 mg (E-Coli)

Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)

Sign In for Pricing
View Details
Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)
MBS1367823-04 0.1 mg (Yeast)

Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)

Sign In for Pricing
View Details
Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)
MBS1367823-05 0.02 mg (Baculovirus)

Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)

Sign In for Pricing
View Details
Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)
MBS1367823-06 0.02 mg (Mammalian-Cell)

Recombinant Aedes aegypti Lissencephaly-1 homolog (AAEL000770)

Sign In for Pricing
View Details