Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Protease protein

This Human Protease protein spans the amino acid sequence from region 1-204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenain Adenovirus protease

UniProt

P03253

Expression Region

1-204aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)

Field of Research

Protein Biochemistry

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-204aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPHSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLKNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF-4-alpha Rabbit monoclonal antibody
BS41449-01 50 µL

HNF-4-alpha Rabbit monoclonal antibody

Sign In for Pricing
View Details
HNF-4-alpha Rabbit monoclonal antibody
BS41449-02 100 µL

HNF-4-alpha Rabbit monoclonal antibody

Sign In for Pricing
View Details
Human C9ORF66 Protein Lysate 20ug
IHUC9ORF66PLLY20UG 20 µg

Human C9ORF66 Protein Lysate 20ug

Sign In for Pricing
View Details
Anti-Keratin-pan KRT2 Antibody
A05667 100 µL

Anti-Keratin-pan KRT2 Antibody

Sign In for Pricing
View Details
CTLA-4, Human (HEK293, His)
HY-P70684-01 10 µg

CTLA-4, Human (HEK293, His)

Sign In for Pricing
View Details
CTLA-4, Human (HEK293, His)
HY-P70684-02 50 µg

CTLA-4, Human (HEK293, His)

Sign In for Pricing
View Details