Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Protein E7 protein

This Human Protein E7 protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E7, Protein E7

UniProt

P03129

Expression Region

1-98aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human papillomavirus type 16

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 6xHis-taggedExpression Region: 1-98aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GARNL3 (NM_001286779) Human Tagged ORF Clone
RC239858 10 µg

GARNL3 (NM_001286779) Human Tagged ORF Clone

Sign In for Pricing
View Details
TNF-IP 8 Polyclonal Antibody
ABP52622-01 30 µL

TNF-IP 8 Polyclonal Antibody

Sign In for Pricing
View Details
TNF-IP 8 Polyclonal Antibody
ABP52622-02 100 µL

TNF-IP 8 Polyclonal Antibody

Sign In for Pricing
View Details
TNF-IP 8 Polyclonal Antibody
ABP52622-03 200 µL

TNF-IP 8 Polyclonal Antibody

Sign In for Pricing
View Details
RIOK3 Rabbit Polyclonal Antibody (Fluoro488)
orb3097634 100 µg

RIOK3 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
CDX2 Recombinant Antibody, PE-Cy5 Conjugated
bsm-52348R-PE-Cy5 100 µL

CDX2 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details