Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Protein E7 protein

This Human Protein E7 protein spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E7, Protein E7

UniProt

P03129

Expression Region

1-98aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Human papillomavirus type 16

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal GST-taggedExpression Region: 1-98aaSequence Info: Partial of NM_000583.3

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin, alpha & beta subunits (Blend) Antibody, Ready-To-Use
MAB496P 7 mL

Tubulin, alpha & beta subunits (Blend) Antibody, Ready-To-Use

Sign In for Pricing
View Details
ARSA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0127608 1.0 µg DNA

ARSA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GATSL3 sgRNA CRISPR Lentivector (Human) (Target 3)
K0843604 1.0 µg DNA

GATSL3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-Inhibin beta C Antibody
MBS8242506-01 0.03 mL

Anti-Inhibin beta C Antibody

Sign In for Pricing
View Details
Anti-Inhibin beta C Antibody
MBS8242506-02 0.05 mL

Anti-Inhibin beta C Antibody

Sign In for Pricing
View Details
Anti-Inhibin beta C Antibody
MBS8242506-03 0.1 mL

Anti-Inhibin beta C Antibody

Sign In for Pricing
View Details