What is the catalog number for Viral Matrix protein 1 protein?

The catalog number for Viral Matrix protein 1 protein is orb419328.

What sizes are available for Viral Matrix protein 1 protein?

Viral Matrix protein 1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Viral Matrix protein 1 protein come in?

Viral Matrix protein 1 protein is available in 3 different pack sizes.

Is Viral Matrix protein 1 protein in stock?

Viral Matrix protein 1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Viral Matrix protein 1 protein

This Viral Matrix protein 1 protein spans the amino acid sequence from region 1-252aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M, Matrix protein 1, M1

UniProt

A4GCL0

Expression Region

1-252aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Influenza A virus (strain A/USA:Iowa/1943 H1N1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 1-252aaSequence Info: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLYRKLKREITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRAIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK