Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPRC protein

This Human SPRC protein spans the amino acid sequence from region 18-303aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Basement-membrane protein 40, Osteonectin, ON, Secreted protein acidic and rich in cysteine

UniProt

P09486

Expression Region

18-303aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 μg/mL, corresponding to a specific activity of > 333 IU/mg.

Form

Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 18-297aaSequence Info: Full Length of Isoform PlGF-2

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP39 (NM_006590) Human Tagged Lenti ORF Clone
RC209551L3 10 µg

USP39 (NM_006590) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human TOMM40L shRNA (UAS) - Lentiviral human TOMM40L shRNA (UAS, RFP) (100)
GTR15328647 1 Vial

Lentiviral human TOMM40L shRNA (UAS) - Lentiviral human TOMM40L shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
BAG5 Antibody
orb1327026 100 µg

BAG5 Antibody

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057769-01 0.1 mL

HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057769-02 0.2 mL

HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057769-03 0.5 mL

HRP-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details