Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SPRC protein

This Human SPRC protein spans the amino acid sequence from region 18-303aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Basement-membrane protein 40, Osteonectin, ON, Secreted protein acidic and rich in cysteine

UniProt

P09486

Expression Region

18-303aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 μg/mL, corresponding to a specific activity of > 333 IU/mg.

Form

Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 18-297aaSequence Info: Full Length of Isoform PlGF-2

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBZ Recombinant Protein (Human)
OPCA04902-20UG 20 µg

HBZ Recombinant Protein (Human)

Sign In for Pricing
View Details
Hmgn1 (NM_001013184) Rat Tagged Lenti ORF Clone
RR205499L4 10 µg

Hmgn1 (NM_001013184) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Myoglobin (MB) (cardiac) mouse monoclonal antibody, clone 7C3
4M23-7C3 1 mg

Myoglobin (MB) (cardiac) mouse monoclonal antibody, clone 7C3

Sign In for Pricing
View Details
AED1 Antibody
orb784294 2 mg

AED1 Antibody

Sign In for Pricing
View Details
Mouse Keratin 13+10, clone EBS-IF-003 (Monoclonal) Antibody
orb557128 100 µg

Mouse Keratin 13+10, clone EBS-IF-003 (Monoclonal) Antibody

Sign In for Pricing
View Details
Phospho-RPS6KA1 (Ser380) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-3362R-BF647 100 µL

Phospho-RPS6KA1 (Ser380) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details