Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLGF protein

This Human PLGF protein spans the amino acid sequence from region 19-170aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

PlGF

UniProt

P49763

Expression Region

19-170aa

Tag

Tag-Free

Source

E.Coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The biologically active as determined by its ability to chemoattract human monocytes using a concentration range of 5.0-50 ng/ml.

Form

Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 19-170aaSequence Info: Partial of Isoform VEGF165

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, with 0.02 % Tween-20

AA Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK2A2 (Casein Kinase 2 alpha, Casein Kinase II Subunit alpha, CK2A2, CSNK2A1, FLJ43934) (FITC)
MBS6412705-01 0.1 mL

CSNK2A2 (Casein Kinase 2 alpha, Casein Kinase II Subunit alpha, CK2A2, CSNK2A1, FLJ43934) (FITC)

Sign In for Pricing
View Details
CSNK2A2 (Casein Kinase 2 alpha, Casein Kinase II Subunit alpha, CK2A2, CSNK2A1, FLJ43934) (FITC)
MBS6412705-02 5x 0.1 mL

CSNK2A2 (Casein Kinase 2 alpha, Casein Kinase II Subunit alpha, CK2A2, CSNK2A1, FLJ43934) (FITC)

Sign In for Pricing
View Details
Proteinase 3 (Proteinase-3, PR3, PR-3, PRTN3, ACPA, Azurophil Granule Protein 7, AGP7, cANCA, c-ANCA Antigen, EC 3.4.21.76, Leukocyte Proteinase 3, MBT, Myeloblastin, MBN, Neutrophil Proteinase 4, NP4, NP-4, p29, Wegener Autoantigen) (MaxLight 750)
MBS6234721-01 0.1 mL

Proteinase 3 (Proteinase-3, PR3, PR-3, PRTN3, ACPA, Azurophil Granule Protein 7, AGP7, cANCA, c-ANCA Antigen, EC 3.4.21.76, Leukocyte Proteinase 3, MBT, Myeloblastin, MBN, Neutrophil Proteinase 4, NP4, NP-4, p29, Wegener Autoantigen) (MaxLight 750)

Sign In for Pricing
View Details
Proteinase 3 (Proteinase-3, PR3, PR-3, PRTN3, ACPA, Azurophil Granule Protein 7, AGP7, cANCA, c-ANCA Antigen, EC 3.4.21.76, Leukocyte Proteinase 3, MBT, Myeloblastin, MBN, Neutrophil Proteinase 4, NP4, NP-4, p29, Wegener Autoantigen) (MaxLight 750)
MBS6234721-02 5x 0.1 mL

Proteinase 3 (Proteinase-3, PR3, PR-3, PRTN3, ACPA, Azurophil Granule Protein 7, AGP7, cANCA, c-ANCA Antigen, EC 3.4.21.76, Leukocyte Proteinase 3, MBT, Myeloblastin, MBN, Neutrophil Proteinase 4, NP4, NP-4, p29, Wegener Autoantigen) (MaxLight 750)

Sign In for Pricing
View Details
Genesig kit for Megasphaera cerevisiae/Megasphaera elsdenii, Easy
348568 1 Kit

Genesig kit for Megasphaera cerevisiae/Megasphaera elsdenii, Easy

Sign In for Pricing
View Details
Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)
MBS2152620-01 0.1 mL

Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)

Sign In for Pricing
View Details