Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat XCL1 protein

This Rat XCL1 protein spans the amino acid sequence from region 22-114aa. Purity: > 97% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

C motif chemokine 1, Small-inducible cytokine C1

UniProt

P51672

Expression Region

22-114aa

Tag

Tag-Free

Source

E.Coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 97% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human XCR1 transfected murine BaF3 cells is less than 100 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 4 IU/mg.

Form

Lyophilized powder

Molecular Weight

10.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 22-114aaSequence Info: Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4

AA Sequence

VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35A2 siRNA (Human)
MBS8208243-01 15 nmol

SLC35A2 siRNA (Human)

Sign In for Pricing
View Details
SLC35A2 siRNA (Human)
MBS8208243-02 30 nmol

SLC35A2 siRNA (Human)

Sign In for Pricing
View Details
SLC35A2 siRNA (Human)
MBS8208243-03 5x 30 nmol

SLC35A2 siRNA (Human)

Sign In for Pricing
View Details
Rat Dipeptidyl Peptidase 3 (DPP3) ELISA Kit
MBS9910091-01 48 Well

Rat Dipeptidyl Peptidase 3 (DPP3) ELISA Kit

Sign In for Pricing
View Details
Rat Dipeptidyl Peptidase 3 (DPP3) ELISA Kit
MBS9910091-02 96 Well

Rat Dipeptidyl Peptidase 3 (DPP3) ELISA Kit

Sign In for Pricing
View Details
Rat Dipeptidyl Peptidase 3 (DPP3) ELISA Kit
MBS9910091-03 5x 96 Well

Rat Dipeptidyl Peptidase 3 (DPP3) ELISA Kit

Sign In for Pricing
View Details