Rat XCL1 protein
This Rat XCL1 protein spans the amino acid sequence from region 22-114aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
C motif chemokine 1, Small-inducible cytokine C1
UniProt
P51672
Expression Region
22-114aa
Tag
Tag-Free
Source
E.Coli
Origin
Rattus norvegicus (Rat)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 97% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human XCR1 transfected murine BaF3 cells is less than 100 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 4 IU/mg.
Form
Lyophilized powder
Molecular Weight
10.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: NO-taggedExpression Region: 22-114aaSequence Info: Full Length of Mature Protein
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4
AA Sequence
VGTEVLQESICVSLRTQRLPVQKIKTYTIKEGAMRAVIFVTKRGLRICADPQAKWVKTAIKTVDGRASASKSKAETIPTQAQRSASTAVTLTG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1108568-01 0.02 mg (E-Coli)
Recombinant Caenorhabditis elegans Uncharacterized kinase-like protein D1044.1 (D1044.1)
Sign In for Pricing
View Details MBS1108568-02 0.02 mg (Yeast)
Recombinant Caenorhabditis elegans Uncharacterized kinase-like protein D1044.1 (D1044.1)
Sign In for Pricing
View Details MBS1108568-03 0.1 mg (E-Coli)
Recombinant Caenorhabditis elegans Uncharacterized kinase-like protein D1044.1 (D1044.1)
Sign In for Pricing
View Details MBS1108568-04 0.1 mg (Yeast)
Recombinant Caenorhabditis elegans Uncharacterized kinase-like protein D1044.1 (D1044.1)
Sign In for Pricing
View Details MBS1108568-05 0.02 mg (Baculovirus)
Recombinant Caenorhabditis elegans Uncharacterized kinase-like protein D1044.1 (D1044.1)
Sign In for Pricing
View Details MBS1108568-06 0.02 mg (Mammalian-Cell)
Recombinant Caenorhabditis elegans Uncharacterized kinase-like protein D1044.1 (D1044.1)
Sign In for Pricing
View Details