Mouse IL36G protein
This Mouse IL36G protein spans the amino acid sequence from region 13-164aa. Purity: > 98% as determined by SDS-PAGE and HPLC.
Product Specifications
Product Name Alternative
Interleukin-1 family member 9
UniProt
Q8R460
Expression Region
13-164aa
Tag
Tag-Free
Source
E.Coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
> 98% as determined by SDS-PAGE and HPLC.
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.
Form
Lyophilized powder
Molecular Weight
17.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag Info: NO-taggedExpression Region: 13-164aaSequence Info: Full Length of Mature Protein
Preservative
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20
AA Sequence
GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS054812-20ug 20 µg
Aftiphilin (AFTPH) (NM_017657) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS6440968-01 0.1 mL
TNFRSF10D (Tumor Necrosis Factor Receptor Superfamily Member 10D, Decoy Receptor 2, DCR2, CD264, TRUNDD, TRAILR4, TRAIL-R4) (MaxLight 550)
Sign In for Pricing
View Details MBS6440968-02 5x 0.1 mL
TNFRSF10D (Tumor Necrosis Factor Receptor Superfamily Member 10D, Decoy Receptor 2, DCR2, CD264, TRUNDD, TRAILR4, TRAIL-R4) (MaxLight 550)
Sign In for Pricing
View Details MBS1001156-01 0.02 mg (E-Coli)
Recombinant Escherichia coli Ribosome-binding factor A (rbfA)
Sign In for Pricing
View Details MBS1001156-02 0.1 mg (E-Coli)
Recombinant Escherichia coli Ribosome-binding factor A (rbfA)
Sign In for Pricing
View Details MBS1001156-03 0.02 mg (Yeast)
Recombinant Escherichia coli Ribosome-binding factor A (rbfA)
Sign In for Pricing
View Details