Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL36G protein

This Mouse IL36G protein spans the amino acid sequence from region 13-164aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Product Specifications

Product Name Alternative

Interleukin-1 family member 9

UniProt

Q8R460

Expression Region

13-164aa

Tag

Tag-Free

Source

E.Coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 98% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 10 ^ 5 IU/mg.

Form

Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag Info: NO-taggedExpression Region: 13-164aaSequence Info: Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20

AA Sequence

GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BHLH094 Antibody
orb838621 2 mg

BHLH094 Antibody

Sign In for Pricing
View Details
PSORS1C2 siRNA (Mouse)
CRM6018-01 15 nmol

PSORS1C2 siRNA (Mouse)

Sign In for Pricing
View Details
PSORS1C2 siRNA (Mouse)
CRM6018-02 30 nmol

PSORS1C2 siRNA (Mouse)

Sign In for Pricing
View Details
UBTF Antibody
CSB-PA060038-01 50 µg

UBTF Antibody

Sign In for Pricing
View Details
UBTF Antibody
CSB-PA060038-02 100 µg

UBTF Antibody

Sign In for Pricing
View Details
PMEPA1 Protein Vector (Mouse) (pPB-N-His)
PV217415 500 ng

PMEPA1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details